PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v1278970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 165aa    MW: 19326.2 Da    PI: 9.8565
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v1278970.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.81e-53151421128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      l pGfrFhPtdeelv +yLk+k+++++l++ e ik++diyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d++++s
  Lj2g3v1278970.1  15 LLPGFRFHPTDEELVGFYLKRKIQQRPLSI-ELIKQLDIYKYDPWDLPKLASTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRPIYS 107
                      579***************************.89***************9888999*************************************** PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + +++ +glkk+Lvfykgra kg+ktdW+mhe+rl
  Lj2g3v1278970.1 108 SeGSKCIGLKKSLVFYKGRAAKGVKTDWMMHEFRL 142
                      956677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-5613146IPR003441NAC domain
PROSITE profilePS5100552.92315165IPR003441NAC domain
PfamPF023651.3E-2617142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MEERNDHAEK LDEVLLPGFR FHPTDEELVG FYLKRKIQQR PLSIELIKQL DIYKYDPWDL  60
PKLASTGEKE WYFYCPRDRK YRNSARPNRV TGAGFWKATG TDRPIYSSEG SKCIGLKKSL  120
VFYKGRAAKG VKTDWMMHEF RLPSLTDPMS QKKYIDKTIP ANVSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-521514217142NO APICAL MERISTEM PROTEIN
1ut4_B4e-521514217142NO APICAL MERISTEM PROTEIN
1ut7_A4e-521514217142NO APICAL MERISTEM PROTEIN
1ut7_B4e-521514217142NO APICAL MERISTEM PROTEIN
3swm_A4e-521514220145NAC domain-containing protein 19
3swm_B4e-521514220145NAC domain-containing protein 19
3swm_C4e-521514220145NAC domain-containing protein 19
3swm_D4e-521514220145NAC domain-containing protein 19
3swp_A4e-521514220145NAC domain-containing protein 19
3swp_B4e-521514220145NAC domain-containing protein 19
3swp_C4e-521514220145NAC domain-containing protein 19
3swp_D4e-521514220145NAC domain-containing protein 19
4dul_A4e-521514217142NAC domain-containing protein 19
4dul_B4e-521514217142NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6619281e-179EU661928.1 Glycine max NAC domain protein (NAC36) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004490046.11e-110PREDICTED: protein FEZ
SwissprotQ9ZVH03e-91FEZ_ARATH; Protein FEZ
TrEMBLA0A0B2P0J91e-109A0A0B2P0J9_GLYSO; Protein FEZ
TrEMBLG7KDY31e-110G7KDY3_MEDTR; NAC domain class transcription factor
TrEMBLI1J5Q41e-109I1J5Q4_SOYBN; Uncharacterized protein
STRINGGLYMA01G05680.11e-109(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.12e-92NAC family protein